ITFG1 antibody (70R-6176)

Rabbit polyclonal ITFG1 antibody raised against the N terminal of ITFG1

Synonyms Polyclonal ITFG1 antibody, Anti-ITFG1 antibody, CDA08 antibody, ITFG1, ITFG-1 antibody, ITFG-1, ITFG 1 antibody, TIP antibody, ITFG 1, Integrin Alpha Fg-Gap Repeat Containing 1 antibody
Specificity ITFG1 antibody was raised against the N terminal of ITFG1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP
Assay Information ITFG1 Blocking Peptide, catalog no. 33R-8970, is also available for use as a blocking control in assays to test for specificity of this ITFG1 antibody

Images

Western Blot analysis using ITFG1 antibody (70R-6176)

ITFG1 antibody (70R-6176) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITFG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ITFG1 antibody (70R-6176) | ITFG1 antibody (70R-6176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors