ITGB1BP2 antibody (70R-1183)

Rabbit polyclonal ITGB1BP2 antibody

Synonyms Polyclonal ITGB1BP2 antibody, Anti-ITGB1BP2 antibody, ITGBBP2 1, ITGBBP2-1, MSTP015 antibody, ITGB1BP2, Melusin 2 antibody, CHORDC3 antibody, ITGBBP2 1 antibody, ITGBBP2-1 antibody, Integrin Beta 1 Binding Protein antibody, ITGB1BP antibody, MGC119214 antibody, MELUSIN antibody
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen ITGB1BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Assay Information ITGB1BP2 Blocking Peptide, catalog no. 33R-6461, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP2 antibody

Images

Immunohistochemical staining using ITGB1BP2 antibody (70R-1183)

ITGB1BP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ITGB1BP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ITGB1BP2 antibody (70R-1183) | ITGB1BP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using ITGB1BP2 antibody (70R-1183) | ITGB1BP2 antibody (70R-1183) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors