ITGB3BP antibody (70R-6093)

Rabbit polyclonal ITGB3BP antibody

Synonyms Polyclonal ITGB3BP antibody, Anti-ITGB3BP antibody, Beta3-Endonexin antibody, ITGB3BP, ITGBBP 3, ITGBBP-3 antibody, HSU37139 antibody, Integrin Beta 3 Binding Protein antibody, CENPR antibody, TAP20 antibody, ITGBBP 3 antibody, CENP-R antibody, ITGBBP-3, NRIF3 antibody
Cross Reactivity Human
Applications WB
Immunogen ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE
Assay Information ITGB3BP Blocking Peptide, catalog no. 33R-9096, is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody

Images

Western Blot analysis using ITGB3BP antibody (70R-6093)

ITGB3BP antibody (70R-6093) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGB3BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ITGB3BP antibody (70R-6093) | ITGB3BP antibody (70R-6093) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors