ITPK1 antibody (70R-3684)

Rabbit polyclonal ITPK1 antibody raised against the middle region of ITPK1

Synonyms Polyclonal ITPK1 antibody, Anti-ITPK1 antibody, ITPK1, ITRPK1 antibody, ITPK 1, ITPK-1 antibody, ITPK-1, ITPK 1 antibody, Inositol 134-Triphosphate 5/6 Kinase antibody
Specificity ITPK1 antibody was raised against the middle region of ITPK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
Assay Information ITPK1 Blocking Peptide, catalog no. 33R-6637, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody


Western Blot analysis using ITPK1 antibody (70R-3684)

ITPK1 antibody (70R-3684) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITPK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ITPK1 antibody (70R-3684) | ITPK1 antibody (70R-3684) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors