IZUMO1 antibody (70R-7523)

Rabbit polyclonal IZUMO1 antibody raised against the C terminal of IZUMO1

Synonyms Polyclonal IZUMO1 antibody, Anti-IZUMO1 antibody, IZUMO 1 antibody, IZUMO-1 antibody, MGC34799 antibody, IZUMO1, Izumo Sperm-Egg Fusion 1 antibody, IZUMO 1, IZUMO-1, IZUMO antibody
Specificity IZUMO1 antibody was raised against the C terminal of IZUMO1
Cross Reactivity Human
Applications WB
Immunogen IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
Assay Information IZUMO1 Blocking Peptide, catalog no. 33R-8575, is also available for use as a blocking control in assays to test for specificity of this IZUMO1 antibody


Western Blot analysis using IZUMO1 antibody (70R-7523)

IZUMO1 antibody (70R-7523) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IZUMO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IZUMO1 antibody (70R-7523) | IZUMO1 antibody (70R-7523) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors