JAKMIP1 antibody (70R-4722)

Rabbit polyclonal JAKMIP1 antibody raised against the middle region of JAKMIP1

Synonyms Polyclonal JAKMIP1 antibody, Anti-JAKMIP1 antibody, MARLIN1 antibody, Janus Kinase And Microtubule Interacting Protein 1 antibody, JAMIP1 antibody, Gababrbp antibody, FLJ31564 antibody
Specificity JAKMIP1 antibody was raised against the middle region of JAKMIP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
Assay Information JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody

Images

Western Blot analysis using JAKMIP1 antibody (70R-4722)

JAKMIP1 antibody (70R-4722) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAKMIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using JAKMIP1 antibody (70R-4722) | JAKMIP1 antibody (70R-4722) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors