JAM3 antibody (70R-7025)

Rabbit polyclonal JAM3 antibody raised against the N terminal of JAM3

Synonyms Polyclonal JAM3 antibody, Anti-JAM3 antibody, Junctional Adhesion Molecule 3 antibody, JAM3, JAM-3 antibody, JAM 3 antibody, JAM 3, JAM-3, JAMC antibody, FLJ14529 antibody, JAM-C antibody
Specificity JAM3 antibody was raised against the N terminal of JAM3
Cross Reactivity Human,Mouse
Applications WB
Immunogen JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
Assay Information JAM3 Blocking Peptide, catalog no. 33R-8834, is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

Images

Western Blot analysis using JAM3 antibody (70R-7025)

JAM3 antibody (70R-7025) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using JAM3 antibody (70R-7025) | JAM3 antibody (70R-7025) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors