JARID2 antibody (70R-5246)

Rabbit polyclonal JARID2 antibody raised against the N terminal of JARID2

Synonyms Polyclonal JARID2 antibody, Anti-JARID2 antibody, JMJ antibody, Jumonji At Rich Interactive Domain 2 antibody
Specificity JARID2 antibody was raised against the N terminal of JARID2
Cross Reactivity Human
Applications WB
Immunogen JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
Assay Information JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody


Western blot analysis using JARID2 antibody (70R-5246)

Recommended JARID2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 139 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JARID2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using JARID2 antibody (70R-5246) | Recommended JARID2 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using JARID2 antibody (70R-5246) | Tissue analyzed: 721_B; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors