Junctophilin 3 antibody (70R-6706)

Rabbit polyclonal Junctophilin 3 antibody raised against the N terminal of JPH3

Synonyms Polyclonal Junctophilin 3 antibody, Anti-Junctophilin 3 antibody, HDL2 antibody, Junctophilin -3 antibody, Junctophilin 3, JP-3 antibody, FLJ44707 antibody, Junctophilin -3, Junctophilin 3 antibody, TNRC22 antibody, Junctophilin 3, JPH3 antibody, JP3 antibody, CAGL237 antibody
Specificity Junctophilin 3 antibody was raised against the N terminal of JPH3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG
Assay Information Junctophilin 3 Blocking Peptide, catalog no. 33R-8805, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 3 antibody

Images

Western Blot analysis using Junctophilin 3 antibody (70R-6706)

Junctophilin 3 antibody (70R-6706) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JPH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH3 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD)-like 2 locus have been identified in the gene that encodes JPH3 protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Junctophilin 3 antibody (70R-6706) | Junctophilin 3 antibody (70R-6706) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors