KAP8.1 antibody (70R-3578)

Rabbit polyclonal KAP8.1 antibody raised against the middle region of KRTAP8-1

Synonyms Polyclonal KAP8.1 antibody, Anti-KAP8.1 antibody, Keratin Associated Protein 8-1 antibody, KAP 8.1, KAP 8.1 antibody, KAP-8.1 antibody, KAP-8.1, KRTAP8-1 antibody, KAP8.1
Specificity KAP8.1 antibody was raised against the middle region of KRTAP8-1
Cross Reactivity Human
Applications WB
Immunogen KAP8.1 antibody was raised using the middle region of KRTAP8-1 corresponding to a region with amino acids LCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGA
Assay Information KAP8.1 Blocking Peptide, catalog no. 33R-4817, is also available for use as a blocking control in assays to test for specificity of this KAP8.1 antibody


Western Blot analysis using KAP8.1 antibody (70R-3578)

KAP8.1 antibody (70R-3578) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 7 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRTAP8-1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRTAP8-1 belongs to the KRTAP type 8 family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KAP8.1 antibody (70R-3578) | KAP8.1 antibody (70R-3578) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors