Karyopherin Alpha 2 antibody (70R-5497)

Rabbit polyclonal Karyopherin Alpha 2 antibody

Synonyms Polyclonal Karyopherin Alpha 2 antibody, Anti-Karyopherin Alpha 2 antibody, Rag Cohort 1 Importin Alpha 1 antibody, QIP2 antibody, IPOA1 antibody, Karyopherin Alpha 2, KPNA2 antibody, SRP1alpha antibody, Karyopherin Alpha 2, RCH1 antibody, Karyopherin Alpha -2 antibody, Karyopherin Alpha 2 antibody, Karyopherin Alpha -2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ
Assay Information Karyopherin Alpha 2 Blocking Peptide, catalog no. 33R-3602, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 2 antibody

Images

Western Blot analysis using Karyopherin Alpha 2 antibody (70R-5497)

Karyopherin Alpha 2 antibody (70R-5497) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Karyopherin Alpha 2 antibody (70R-5497) | Karyopherin Alpha 2 antibody (70R-5497) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors