Karyopherin Alpha 6 antibody (70R-2070)

Rabbit polyclonal Karyopherin Alpha 6 antibody

Synonyms Polyclonal Karyopherin Alpha 6 antibody, Anti-Karyopherin Alpha 6 antibody, KPNA7 antibody, Karyopherin Alpha 6, Karyopherin Alpha 6 antibody, Karyopherin Alpha -6, Karyopherin Alpha -6 antibody, Importin Alpha 7 antibody, IPOA7 antibody, MGC17918 antibody, FLJ11249 antibody, KPNA6 antibody, Karyopherin Alpha 6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP
Assay Information Karyopherin Alpha 6 Blocking Peptide, catalog no. 33R-8891, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 6 antibody

Images

Western Blot analysis using Karyopherin Alpha 6 antibody (70R-2070)

Karyopherin Alpha 6 antibody (70R-2070) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Karyopherin Alpha 6 antibody (70R-2070) | Karyopherin Alpha 6 antibody (70R-2070) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors