KCNAB2 antibody (70R-1506)

Rabbit polyclonal KCNAB2 antibody raised against the C terminal of KCNAB2

Synonyms Polyclonal KCNAB2 antibody, Anti-KCNAB2 antibody, KCNAB-2, KCNAB2, Potassium Voltage-Gated Channel Shaker-Related Subfamily Beta Member 2 antibody, KCNAB 2, KCNAB-2 antibody, KCNAB 2 antibody
Specificity KCNAB2 antibody was raised against the C terminal of KCNAB2
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL
Assay Information KCNAB2 Blocking Peptide, catalog no. 33R-4735, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Images

Western Blot analysis using KCNAB2 antibody (70R-1506)

KCNAB2 antibody (70R-1506) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNAB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNAB2 antibody (70R-1506) | KCNAB2 antibody (70R-1506) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors