KCNAB2 antibody (70R-5049)

Rabbit polyclonal KCNAB2 antibody raised against the middle region of KCNAB2

Synonyms Polyclonal KCNAB2 antibody, Anti-KCNAB2 antibody, KCNAB 2 antibody, KCNAB-2 antibody, KCNAB 2, Potassium Voltage-Gated Channel Shaker-Related Subfamily Beta Member 2 antibody, KCNAB-2, KCNAB2
Specificity KCNAB2 antibody was raised against the middle region of KCNAB2
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV


Western Blot analysis using KCNAB2 antibody (70R-5049)

KCNAB2 antibody (70R-5049) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNAB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNAB2 antibody (70R-5049) | KCNAB2 antibody (70R-5049) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors