KCNC4 antibody (70R-5155)

Rabbit polyclonal KCNC4 antibody raised against the middle region of KCNC4

Synonyms Polyclonal KCNC4 antibody, Anti-KCNC4 antibody, KSHIIIC antibody, MGC126818 antibody, KV3.4 antibody, KCNC 4, Potassium Voltage-Gated Channel Shaw-Related Subfamily Member 4 antibody, HKSHIIIC antibody, KCNC-4 antibody, KCNC 4 antibody, KCNC-4, KCNC4
Specificity KCNC4 antibody was raised against the middle region of KCNC4
Cross Reactivity Human
Applications WB
Immunogen KCNC4 antibody was raised using the middle region of KCNC4 corresponding to a region with amino acids NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV
Assay Information KCNC4 Blocking Peptide, catalog no. 33R-6717, is also available for use as a blocking control in assays to test for specificity of this KCNC4 antibody


Immunohistochemical staining using KCNC4 antibody (70R-5155)

Skeletal muscle


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNC4 is part of the Shaker gene family of Drosophila. It encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. KCNC4 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNC4 antibody (70R-5155) | Skeletal muscle
  • Western blot analysis using KCNC4 antibody (70R-5155) | Recommended KCNC4 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors