KCND3 antibody (70R-5186)

Rabbit polyclonal KCND3 antibody raised against the middle region of KCND3

Synonyms Polyclonal KCND3 antibody, Anti-KCND3 antibody, KCND-3 antibody, KCND 3, KCND3L antibody, KCND3S antibody, KSHIVB antibody, Potassium Voltage-Gated Channel Shal-Related Subfamily Member 3 antibody, KCND-3, MGC142037 antibody, KCND3, KCND 3 antibody, MGC142035 antibody, KV4.3 antibody
Specificity KCND3 antibody was raised against the middle region of KCND3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH
Assay Information KCND3 Blocking Peptide, catalog no. 33R-9423, is also available for use as a blocking control in assays to test for specificity of this KCND3 antibody

Images

Western Blot analysis using KCND3 antibody (70R-5186)

KCND3 antibody (70R-5186) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCND3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCND3 antibody (70R-5186) | KCND3 antibody (70R-5186) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors