KCNG1 antibody (70R-5177)

Rabbit polyclonal KCNG1 antibody raised against the N terminal of KCNG1

Synonyms Polyclonal KCNG1 antibody, Anti-KCNG1 antibody, KCNG-1 antibody, KCNG 1 antibody, MGC12878 antibody, KCNG 1, KCNG antibody, KV6.1 antibody, KCNG-1, kH2 antibody, Potassium Voltage-Gated Channel Subfamily G Member 1 antibody, K13 antibody, KCNG1
Specificity KCNG1 antibody was raised against the N terminal of KCNG1
Cross Reactivity Human
Applications WB
Immunogen KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD
Assay Information KCNG1 Blocking Peptide, catalog no. 33R-6552, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody


Western Blot analysis using KCNG1 antibody (70R-5177)

KCNG1 antibody (70R-5177) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNG1 antibody (70R-5177) | KCNG1 antibody (70R-5177) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors