KCNH2 antibody (70R-5165)

Rabbit polyclonal KCNH2 antibody

Synonyms Polyclonal KCNH2 antibody, Anti-KCNH2 antibody, HERG1 antibody, KCNH 2 antibody, KCNH-2 antibody, SQT1 antibody, HERG antibody, KCNH2, LQT2 antibody, KCNH 2, KCNH-2, ERG1 antibody, Potassium Voltage-Gated Channel Subfamily H antibody, Eag-Related 2 antibody, Kv11.1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG
Assay Information KCNH2 Blocking Peptide, catalog no. 33R-8732, is also available for use as a blocking control in assays to test for specificity of this KCNH2 antibody

Images

Western Blot analysis using KCNH2 antibody (70R-5165)

KCNH2 antibody (70R-5165) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNH2 antibody (70R-5165) | KCNH2 antibody (70R-5165) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors