KCNH7 antibody (70R-5110)

Rabbit polyclonal KCNH7 antibody

Synonyms Polyclonal KCNH7 antibody, Anti-KCNH7 antibody, Kv11.3 antibody, ERG3 antibody, KCNH 7 antibody, KCNH7, HERG3 antibody, KCNH-7 antibody, Eag-Related 7 antibody, MGC45986 antibody, KCNH 7, Potassium Voltage-Gated Channel Subfamily H antibody, KCNH-7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNH7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV
Assay Information KCNH7 Blocking Peptide, catalog no. 33R-7158, is also available for use as a blocking control in assays to test for specificity of this KCNH7 antibody


Western Blot analysis using KCNH7 antibody (70R-5110)

KCNH7 antibody (70R-5110) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNH7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNH7 antibody (70R-5110) | KCNH7 antibody (70R-5110) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors