KCNJ1 antibody (70R-5144)

Rabbit polyclonal KCNJ1 antibody raised against the middle region of KCNJ1

Synonyms Polyclonal KCNJ1 antibody, Anti-KCNJ1 antibody, KCNJ1, KCNJ-1, Potassium Inwardly-Rectifying Channel Subfamily J Member 1 antibody, KCNJ 1 antibody, KCNJ-1 antibody, ROMK1 antibody, KCNJ 1, ROMK antibody, KIR1.1 antibody
Specificity KCNJ1 antibody was raised against the middle region of KCNJ1
Cross Reactivity Human
Applications WB
Immunogen KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
Assay Information KCNJ1 Blocking Peptide, catalog no. 33R-5365, is also available for use as a blocking control in assays to test for specificity of this KCNJ1 antibody


Western Blot analysis using KCNJ1 antibody (70R-5144)

KCNJ1 antibody (70R-5144) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNJ1 has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for KCNJ1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNJ1 antibody (70R-5144) | KCNJ1 antibody (70R-5144) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors