KCNJ5 antibody (70R-5134)

Rabbit polyclonal KCNJ5 antibody raised against the N terminal of KCNJ5

Synonyms Polyclonal KCNJ5 antibody, Anti-KCNJ5 antibody, Potassium Inwardly-Rectifying Channel Subfamily J Member 5 antibody, KCNJ 5, KCNJ 5 antibody, KCNJ-5, CIR antibody, KCNJ5, KCNJ-5 antibody, GIRK4 antibody, KIR3.4 antibody, KATP1 antibody
Specificity KCNJ5 antibody was raised against the N terminal of KCNJ5
Cross Reactivity Human
Applications WB
Immunogen KCNJ5 antibody was raised using the N terminal of KCNJ5 corresponding to a region with amino acids AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ
Assay Information KCNJ5 Blocking Peptide, catalog no. 33R-1190, is also available for use as a blocking control in assays to test for specificity of this KCNJ5 antibody

Images

Western Blot analysis using KCNJ5 antibody (70R-5134)

KCNJ5 antibody (70R-5134) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ5 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ5, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It may associate with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNJ5 antibody (70R-5134) | KCNJ5 antibody (70R-5134) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors