KCNK1 antibody (70R-5220)

Rabbit polyclonal KCNK1 antibody raised against the middle region of KCNK1

Synonyms Polyclonal KCNK1 antibody, Anti-KCNK1 antibody, Potassium Channel Subfamily K Member 1 antibody, KCNK-1 antibody, HOHO antibody, KCNK-1, K2p1.1 antibody, DPK antibody, TWIK1 antibody, KCNK 1 antibody, TWIK-1 antibody, KCNK 1, KCNK1
Specificity KCNK1 antibody was raised against the middle region of KCNK1
Cross Reactivity Human
Applications WB
Immunogen KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Assay Information KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Images

Western Blot analysis using KCNK1 antibody (70R-5220)

KCNK1 antibody (70R-5220) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNK1 antibody (70R-5220) | KCNK1 antibody (70R-5220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors