KCNK10 antibody (70R-1533)

Rabbit polyclonal KCNK10 antibody raised against the C terminal of KCNK10

Synonyms Polyclonal KCNK10 antibody, Anti-KCNK10 antibody, KCNK-10 antibody, Potassium Channel Subfamily K Member 10 antibody, KCNK 10 antibody, KCNK-10, KCNK 10, KCNK10
Specificity KCNK10 antibody was raised against the C terminal of KCNK10
Cross Reactivity Human
Applications WB
Immunogen KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK
Assay Information KCNK10 Blocking Peptide, catalog no. 33R-7555, is also available for use as a blocking control in assays to test for specificity of this KCNK10 antibody


Western Blot analysis using KCNK10 antibody (70R-1533)

KCNK10 antibody (70R-1533) used at 1.4 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNK10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.4 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNK10 antibody (70R-1533) | KCNK10 antibody (70R-1533) used at 1.4 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors