KCNK15 antibody (70R-5222)

Rabbit polyclonal KCNK15 antibody raised against the middle region of KCNK15

Synonyms Polyclonal KCNK15 antibody, Anti-KCNK15 antibody, KCNK14 antibody, Potassium Channel Subfamily K Member 15 antibody, KIAA0237 antibody, KCNK 15 antibody, KCNK11 antibody, KCNK 15, dJ781B1.1 antibody, K2p15.1 antibody, KT3.3 antibody, KCNK-15 antibody, TASK-5 antibody, KCNK15, KCNK-15, TASK5 antibody
Specificity KCNK15 antibody was raised against the middle region of KCNK15
Cross Reactivity Human
Applications WB
Immunogen KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI
Assay Information KCNK15 Blocking Peptide, catalog no. 33R-1496, is also available for use as a blocking control in assays to test for specificity of this KCNK15 antibody


Western Blot analysis using KCNK15 antibody (70R-5222)

KCNK15 antibody (70R-5222) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK15 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK15 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNK15 antibody (70R-5222) | KCNK15 antibody (70R-5222) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors