KCNK4 antibody (70R-5192)

Rabbit polyclonal KCNK4 antibody raised against the N terminal of KCNK4

Synonyms Polyclonal KCNK4 antibody, Anti-KCNK4 antibody, KCNK 4 antibody, KCNK-4, KCNK-4 antibody, Potassium Channel Subfamily K Member 4 antibody, K2p4.1 antibody, KCNK4, KCNK 4, TRAAK antibody, TRAAK1 antibody
Specificity KCNK4 antibody was raised against the N terminal of KCNK4
Cross Reactivity Human
Applications WB
Immunogen KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
Assay Information KCNK4 Blocking Peptide, catalog no. 33R-6385, is also available for use as a blocking control in assays to test for specificity of this KCNK4 antibody


Western Blot analysis using KCNK4 antibody (70R-5192)

KCNK4 antibody (70R-5192) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNK4 antibody (70R-5192) | KCNK4 antibody (70R-5192) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors