KCNMA1 antibody (70R-5126)

Rabbit polyclonal KCNMA1 antibody raised against the middle region of KCNMA1

Synonyms Polyclonal KCNMA1 antibody, Anti-KCNMA1 antibody, KCNMA 1, DKFZp686K1437 antibody, mSLO1 antibody, SLO antibody, KCNMA-1 antibody, KCNMA 1 antibody, MGC71881 antibody, KCa1.1 antibody, BKTM antibody, Potassium Large Conductance Calcium-Activated Channel Subfamily M Alpha Member 1 antibody, SLO-ALPHA antibody, SAKCA antibody, KCNMA-1, KCNMA1, MaxiK antibody
Specificity KCNMA1 antibody was raised against the middle region of KCNMA1
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD
Assay Information KCNMA1 Blocking Peptide, catalog no. 33R-2744, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody

Images

Western Blot analysis using KCNMA1 antibody (70R-5126)

KCNMA1 antibody (70R-5126) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 131 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNMA1 antibody (70R-5126) | KCNMA1 antibody (70R-5126) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors