KCNMA1 antibody (70R-5152)

Rabbit polyclonal KCNMA1 antibody raised against the middle region of KCNMA1

Synonyms Polyclonal KCNMA1 antibody, Anti-KCNMA1 antibody, MGC71881 antibody, KCNMA 1 antibody, SLO-ALPHA antibody, KCNMA-1 antibody, KCa1.1 antibody, Potassium Large Conductance Calcium-Activated Channel Subfamily M Alpha Member 1 antibody, KCNMA 1, SAKCA antibody, mSLO1 antibody, KCNMA-1, SLO antibody, DKFZp686K1437 antibody, MaxiK antibody, KCNMA1, BKTM antibody
Specificity KCNMA1 antibody was raised against the middle region of KCNMA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Assay Information KCNMA1 Blocking Peptide, catalog no. 33R-1683, is also available for use as a blocking control in assays to test for specificity of this KCNMA1 antibody


Western Blot analysis using KCNMA1 antibody (70R-5152)

KCNMA1 antibody (70R-5152) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 131 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNMA1 antibody (70R-5152) | KCNMA1 antibody (70R-5152) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors