KCNN2 antibody (70R-1495)

Rabbit polyclonal KCNN2 antibody raised against the C terminal of KCNN2

Synonyms Polyclonal KCNN2 antibody, Anti-KCNN2 antibody, KCNN2, Potassium Intermediate/Small Conductance Calcium-Activated Channel Subfamily N Member 2 antibody, KCNN 2, KCNN-2, KCNN 2 antibody, KCNN-2 antibody
Specificity KCNN2 antibody was raised against the C terminal of KCNN2
Cross Reactivity Human
Applications WB
Immunogen KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Assay Information KCNN2 Blocking Peptide, catalog no. 33R-3914, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Western Blot analysis using KCNN2 antibody (70R-1495)

KCNN2 antibody (70R-1495) used at 1.25 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using KCNN2 antibody (70R-1495) | KCNN2 antibody (70R-1495) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors