KCNQ4 antibody (70R-5075)

Rabbit polyclonal KCNQ4 antibody raised against the middle region of KCNQ4

Synonyms Polyclonal KCNQ4 antibody, Anti-KCNQ4 antibody, DFNA2 antibody, KV7.4 antibody, KCNQ-4, KCNQ-4 antibody, Potassium Voltage-Gated Channel Kqt-Like Subfamily Member 4 antibody, KCNQ4, KCNQ 4 antibody, KCNQ 4
Specificity KCNQ4 antibody was raised against the middle region of KCNQ4
Cross Reactivity Human
Applications WB
Immunogen KCNQ4 antibody was raised using the middle region of KCNQ4 corresponding to a region with amino acids SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ
Assay Information KCNQ4 Blocking Peptide, catalog no. 33R-8845, is also available for use as a blocking control in assays to test for specificity of this KCNQ4 antibody


Western Blot analysis using KCNQ4 antibody (70R-5075)

KCNQ4 antibody (70R-5075) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNQ4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNQ4 antibody (70R-5075) | KCNQ4 antibody (70R-5075) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors