KCNRG antibody (70R-5094)

Rabbit polyclonal KCNRG antibody raised against the N terminal of KCNRG

Synonyms Polyclonal KCNRG antibody, Anti-KCNRG antibody, DLTET antibody, Potassium Channel Regulator antibody
Specificity KCNRG antibody was raised against the N terminal of KCNRG
Cross Reactivity Human
Applications WB
Immunogen KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF
Assay Information KCNRG Blocking Peptide, catalog no. 33R-6505, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody


Western Blot analysis using KCNRG antibody (70R-5094)

KCNRG antibody (70R-5094) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNRG antibody (70R-5094) | KCNRG antibody (70R-5094) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors