KCNS1 antibody (70R-5154)

Rabbit polyclonal KCNS1 antibody raised against the N terminal of KCNS1

Synonyms Polyclonal KCNS1 antibody, Anti-KCNS1 antibody, KV9.1 antibody, Potassium Voltage-Gated Channel Delayed-Rectifier Subfamily S Member 1 antibody, KCNS-1, KCNS 1, KCNS1, KCNS-1 antibody, KCNS 1 antibody
Specificity KCNS1 antibody was raised against the N terminal of KCNS1
Cross Reactivity Human
Applications WB
Immunogen KCNS1 antibody was raised using the N terminal of KCNS1 corresponding to a region with amino acids LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEA
Assay Information KCNS1 Blocking Peptide, catalog no. 33R-5206, is also available for use as a blocking control in assays to test for specificity of this KCNS1 antibody

Images

Western Blot analysis using KCNS1 antibody (70R-5154)

KCNS1 antibody (70R-5154) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. KCNS1 is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNS1 antibody (70R-5154) | KCNS1 antibody (70R-5154) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors