KCNV2 antibody (70R-5119)

Rabbit polyclonal KCNV2 antibody raised against the N terminal of KCNV2

Synonyms Polyclonal KCNV2 antibody, Anti-KCNV2 antibody, MGC120515 antibody, KCNV 2 antibody, Potassium Channel Subfamily V Member 2 antibody, KCNV2, Kv8.2 antibody, KCNV-2, KCNV-2 antibody, KV11.1 antibody, KCNV 2
Specificity KCNV2 antibody was raised against the N terminal of KCNV2
Cross Reactivity Human
Applications WB
Immunogen KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
Assay Information KCNV2 Blocking Peptide, catalog no. 33R-8183, is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody

Images

Western Blot analysis using KCNV2 antibody (70R-5119)

KCNV2 antibody (70R-5119) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNV2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNV2 antibody (70R-5119) | KCNV2 antibody (70R-5119) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors