KCTD13 antibody (70R-5089)

Rabbit polyclonal KCTD13 antibody raised against the N terminal of KCTD13

Synonyms Polyclonal KCTD13 antibody, Anti-KCTD13 antibody, KCTD-13 antibody, Potassium Channel Tetramerisation Domain Containing 13 antibody, KCTD 13 antibody, KCTD 13, KCTD13, KCTD-13
Specificity KCTD13 antibody was raised against the N terminal of KCTD13
Cross Reactivity Human, Dog
Applications IHC, WB
Immunogen KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
Assay Information KCTD13 Blocking Peptide, catalog no. 33R-7119, is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody


Immunohistochemical staining using KCTD13 antibody (70R-5089)

KCTD13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCTD13 antibody (70R-5089) | KCTD13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using KCTD13 antibody (70R-5089) | KCTD13 antibody (70R-5089) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors