KCTD17 antibody (70R-5074)

Rabbit polyclonal KCTD17 antibody raised against the middle region of KCTD17

Synonyms Polyclonal KCTD17 antibody, Anti-KCTD17 antibody, KCTD17, KCTD-17 antibody, KCTD-17, Potassium Channel Tetramerisation Domain Containing 17 antibody, KCTD 17, KCTD 17 antibody, FLJ12242 antibody
Specificity KCTD17 antibody was raised against the middle region of KCTD17
Cross Reactivity Human
Applications WB
Immunogen KCTD17 antibody was raised using the middle region of KCTD17 corresponding to a region with amino acids YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE
Assay Information KCTD17 Blocking Peptide, catalog no. 33R-10111, is also available for use as a blocking control in assays to test for specificity of this KCTD17 antibody

Images

Western Blot analysis using KCTD17 antibody (70R-5074)

KCTD17 antibody (70R-5074) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD17 may be involved in identical protein binding and voltage-gated potassium channel activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCTD17 antibody (70R-5074) | KCTD17 antibody (70R-5074) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors