KCTD19 antibody (70R-5057)

Rabbit polyclonal KCTD19 antibody raised against the n terminal of KCTD19

Synonyms Polyclonal KCTD19 antibody, Anti-KCTD19 antibody, KCTD-19 antibody, KCTD 19, KCTD 19 antibody, Potassium Channel Tetramerisation Domain Containing 19 antibody, FLJ40162 antibody, KCTD-19, KCTD19
Specificity KCTD19 antibody was raised against the n terminal of KCTD19
Cross Reactivity Human
Applications WB
Immunogen KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL
Assay Information KCTD19 Blocking Peptide, catalog no. 33R-2168, is also available for use as a blocking control in assays to test for specificity of this KCTD19 antibody


Western Blot analysis using KCTD19 antibody (70R-5057)

KCTD19 antibody (70R-5057) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KCTD19 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD19 antibody (70R-5057) | KCTD19 antibody (70R-5057) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors