KCTD21 antibody (70R-3766)

Rabbit polyclonal KCTD21 antibody raised against the middle region of KCTD21

Synonyms Polyclonal KCTD21 antibody, Anti-KCTD21 antibody, Potassium Channel Tetramerisation Domain Containing 21 antibody, KCTD 21 antibody, KCTD21, KCTD 21, KCTD-21, KCTD-21 antibody
Specificity KCTD21 antibody was raised against the middle region of KCTD21
Cross Reactivity Human
Applications WB
Immunogen KCTD21 antibody was raised using the middle region of KCTD21 corresponding to a region with amino acids VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV
Assay Information KCTD21 Blocking Peptide, catalog no. 33R-9533, is also available for use as a blocking control in assays to test for specificity of this KCTD21 antibody


Western Blot analysis using KCTD21 antibody (70R-3766)

KCTD21 antibody (70R-3766) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD21 antibody (70R-3766) | KCTD21 antibody (70R-3766) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors