KCTD4 antibody (70R-5091)

Rabbit polyclonal KCTD4 antibody raised against the N terminal of KCTD4

Synonyms Polyclonal KCTD4 antibody, Anti-KCTD4 antibody, KCTD 4, Potassium Channel Tetramerisation Domain Containing 4 antibody, bA321C24.3 antibody, KCTD 4 antibody, KCTD4, KCTD-4 antibody, KCTD-4
Specificity KCTD4 antibody was raised against the N terminal of KCTD4
Cross Reactivity Human,Mouse
Applications WB
Immunogen KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL
Assay Information KCTD4 Blocking Peptide, catalog no. 33R-6554, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody


Western Blot analysis using KCTD4 antibody (70R-5091)

KCTD4 antibody (70R-5091) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD4 antibody (70R-5091) | KCTD4 antibody (70R-5091) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors