KCTD6 antibody (70R-1505)

Rabbit polyclonal KCTD6 antibody raised against the N terminal of KCTD6

Synonyms Polyclonal KCTD6 antibody, Anti-KCTD6 antibody, KCTD-6, Potassium Channel Tetramerisation Domain Containing 6 antibody, KCTD 6, KCTD 6 antibody, MGC27385 antibody, KCTD-6 antibody, KCTD6
Specificity KCTD6 antibody was raised against the N terminal of KCTD6
Cross Reactivity Human
Applications IHC, WB
Immunogen KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN
Assay Information KCTD6 Blocking Peptide, catalog no. 33R-3794, is also available for use as a blocking control in assays to test for specificity of this KCTD6 antibody


Immunohistochemical staining using KCTD6 antibody (70R-1505)

KCTD6 antibody was used for immunohistochemistry at a concentration of 16.0 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCTD6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD6 is a domain of potassium channel.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCTD6 antibody (70R-1505) | KCTD6 antibody was used for immunohistochemistry at a concentration of 16.0 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using KCTD6 antibody (70R-1505) | KCTD6 antibody (70R-1505) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors