KDELR3 antibody (70R-7476)

Rabbit polyclonal KDELR3 antibody

Synonyms Polyclonal KDELR3 antibody, Anti-KDELR3 antibody, KDELR-3 antibody, KDELR3, Lys-Asp-Glu-Leu Endoplasmic Reticulum Protein Retention Receptor 3 antibody, KDELR 3, KDELR 3 antibody, KDELR-3, Kdel antibody, ERD2L3 antibody
Cross Reactivity Human
Applications WB
Immunogen KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
Assay Information KDELR3 Blocking Peptide, catalog no. 33R-1635, is also available for use as a blocking control in assays to test for specificity of this KDELR3 antibody

Images

Western Blot analysis using KDELR3 antibody (70R-7476)

KDELR3 antibody (70R-7476) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KDELR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (kDaEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognises, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the kDaEL receptor gene family, have been described. kDaELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to kDaELR1 and kDaELR2 proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KDELR3 antibody (70R-7476) | KDELR3 antibody (70R-7476) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors