KHDRBS1 antibody (70R-5674)

Rabbit polyclonal KHDRBS1 antibody raised against the N terminal of KHDRBS1

Synonyms Polyclonal KHDRBS1 antibody, Anti-KHDRBS1 antibody, KHDRBS 1 antibody, KHDRBS-1 antibody, Kh Domain Containing Rna Binding Signal Transduction Associated 1 antibody, Sam68 antibody, KHDRBS1, FLJ34027 antibody, KHDRBS-1, KHDRBS 1, p62 antibody
Specificity KHDRBS1 antibody was raised against the N terminal of KHDRBS1
Cross Reactivity Human
Applications WB
Immunogen KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN
Assay Information KHDRBS1 Blocking Peptide, catalog no. 33R-5263, is also available for use as a blocking control in assays to test for specificity of this KHDRBS1 antibody

Images

Western Blot analysis using KHDRBS1 antibody (70R-5674)

KHDRBS1 antibody (70R-5674) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KHDRBS1 antibody (70R-5674) | KHDRBS1 antibody (70R-5674) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors