KHDRBS3 antibody (70R-4610)

Rabbit polyclonal KHDRBS3 antibody raised against the C terminal of KHDRBS3

Synonyms Polyclonal KHDRBS3 antibody, Anti-KHDRBS3 antibody, KHDRBS-3, KHDRBS 3, KHDRBS-3 antibody, Kh Domain Containing Rna Binding Signal Transduction Associated 3 antibody, KHDRBS 3 antibody, KHDRBS3
Specificity KHDRBS3 antibody was raised against the C terminal of KHDRBS3
Cross Reactivity Human
Applications IHC, WB
Immunogen KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
Assay Information KHDRBS3 Blocking Peptide, catalog no. 33R-2680, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Images

Immunohistochemical staining using KHDRBS3 antibody (70R-4610)

KHDRBS3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KHDRBS3 antibody (70R-4610) | KHDRBS3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KHDRBS3 antibody (70R-4610) | KHDRBS3 antibody (70R-4610) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors