KHDRBS3 antibody (70R-4910)

Rabbit polyclonal KHDRBS3 antibody raised against the N terminal of KHDRBS3

Synonyms Polyclonal KHDRBS3 antibody, Anti-KHDRBS3 antibody, SLM2 antibody, etoile antibody, KHDRBS 3, SALP antibody, KHDRBS-3 antibody, TSTAR antibody, KHDRBS 3 antibody, Kh Domain Containing Rna Binding Signal Transduction Associated 3 antibody, T-STAR antibody, SLM-2 antibody, Etle antibody, KHDRBS3, KHDRBS-3
Specificity KHDRBS3 antibody was raised against the N terminal of KHDRBS3
Cross Reactivity Human
Applications WB
Immunogen KHDRBS3 antibody was raised using the N terminal of KHDRBS3 corresponding to a region with amino acids MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVI
Assay Information KHDRBS3 Blocking Peptide, catalog no. 33R-5904, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Images

Western Blot analysis using KHDRBS3 antibody (70R-4910)

KHDRBS3 antibody (70R-4910) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KHDRBS3 antibody (70R-4910) | KHDRBS3 antibody (70R-4910) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors