KHSRP antibody (70R-4811)

Rabbit polyclonal KHSRP antibody raised against the middle region of KHSRP

Synonyms Polyclonal KHSRP antibody, Anti-KHSRP antibody, FBP2 antibody, FUBP2 antibody, MGC99676 antibody, KSRP antibody, Kh-Type Splicing Regulatory Protein antibody
Specificity KHSRP antibody was raised against the middle region of KHSRP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
Assay Information KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody


Western Blot analysis using KHSRP antibody (70R-4811)

KHSRP antibody (70R-4811) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHSRP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KHSRP antibody (70R-4811) | KHSRP antibody (70R-4811) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors