KIAA0020 antibody (70R-5015)

Rabbit polyclonal KIAA0020 antibody raised against the N terminal of KIAA0020

Synonyms Polyclonal KIAA0020 antibody, Anti-KIAA0020 antibody, KIAA0020, KIAA00 20 antibody, KIAA00 20, XTP5 antibody, KIAA00-20, HLA-HA8 antibody, KIAA00-20 antibody, PUF6 antibody, Kiaa0020 antibody, PEN antibody, MGC8749 antibody
Specificity KIAA0020 antibody was raised against the N terminal of KIAA0020
Cross Reactivity Human
Applications WB
Immunogen KIAA0020 antibody was raised using the N terminal of KIAA0020 corresponding to a region with amino acids EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR
Assay Information KIAA0020 Blocking Peptide, catalog no. 33R-2794, is also available for use as a blocking control in assays to test for specificity of this KIAA0020 antibody


Western Blot analysis using KIAA0020 antibody (70R-5015)

KIAA0020 antibody (70R-5015) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0020 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0020 antibody (70R-5015) | KIAA0020 antibody (70R-5015) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors