KIAA0247 antibody (70R-7403)

Rabbit polyclonal KIAA0247 antibody raised against the N terminal of KIAA0247

Synonyms Polyclonal KIAA0247 antibody, Anti-KIAA0247 antibody, KIAA0247, KIAA0 247 antibody, Kiaa0247 antibody, KIAA0-247, KIAA0-247 antibody, KIAA0 247
Specificity KIAA0247 antibody was raised against the N terminal of KIAA0247
Cross Reactivity Human
Applications WB
Immunogen KIAA0247 antibody was raised using the N terminal of KIAA0247 corresponding to a region with amino acids YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI
Assay Information KIAA0247 Blocking Peptide, catalog no. 33R-10161, is also available for use as a blocking control in assays to test for specificity of this KIAA0247 antibody

Images

Western Blot analysis using KIAA0247 antibody (70R-7403)

KIAA0247 antibody (70R-7403) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0247 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0247 is a single-pass type I membrane protein. It contains 1 Sushi (CCP/SCR) domain. The function of the KIAA0247 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0247 antibody (70R-7403) | KIAA0247 antibody (70R-7403) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors