KIAA0317 antibody (70R-6284)

Rabbit polyclonal KIAA0317 antibody raised against the N terminal of KIAA0317

Synonyms Polyclonal KIAA0317 antibody, Anti-KIAA0317 antibody, KIAA0-317, KIAA0 317 antibody, KIAA0-317 antibody, Kiaa0317 antibody, KIAA0317, KIAA0 317
Specificity KIAA0317 antibody was raised against the N terminal of KIAA0317
Cross Reactivity Human
Applications WB
Immunogen KIAA0317 antibody was raised using the N terminal of KIAA0317 corresponding to a region with amino acids LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV
Assay Information KIAA0317 Blocking Peptide, catalog no. 33R-5469, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Images

Western Blot analysis using KIAA0317 antibody (70R-6284)

KIAA0317 antibody (70R-6284) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0317 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0317 antibody (70R-6284) | KIAA0317 antibody (70R-6284) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors