KIAA0317 antibody (70R-6288)

Rabbit polyclonal KIAA0317 antibody raised against the middle region of KIAA0317

Synonyms Polyclonal KIAA0317 antibody, Anti-KIAA0317 antibody, KIAA0 317, KIAA0-317, KIAA0317, KIAA0 317 antibody, Kiaa0317 antibody, KIAA0-317 antibody
Specificity KIAA0317 antibody was raised against the middle region of KIAA0317
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF
Assay Information KIAA0317 Blocking Peptide, catalog no. 33R-9768, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Images

Western Blot analysis using KIAA0317 antibody (70R-6288)

KIAA0317 antibody (70R-6288) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0317 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0317 antibody (70R-6288) | KIAA0317 antibody (70R-6288) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors