KIAA0692 antibody (70R-3254)

Rabbit polyclonal KIAA0692 antibody raised against the middle region of Kiaa0692

Synonyms Polyclonal KIAA0692 antibody, Anti-KIAA0692 antibody, FLJ22280 antibody, KIAA 0692, KIAA0692, KIAA-692 antibody, FLJ36132 antibody, KIAA 0692 antibody, KIAA-692
Specificity KIAA0692 antibody was raised against the middle region of Kiaa0692
Cross Reactivity Human
Applications WB
Immunogen KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
Assay Information KIAA0692 Blocking Peptide, catalog no. 33R-1839, is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody


Western Blot analysis using KIAA0692 antibody (70R-3254)

KIAA0692 antibody (70R-3254) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0692 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0692 antibody (70R-3254) | KIAA0692 antibody (70R-3254) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors