KIAA0776 antibody (70R-3793)

Rabbit polyclonal KIAA0776 antibody raised against the middle region of KIAA0776

Synonyms Polyclonal KIAA0776 antibody, Anti-KIAA0776 antibody, KIAA-776 antibody, KIAA-776, Kiaa0776 antibody, KIAA 0776 antibody, KIAA 0776, KIAA0776, RP3-393D12.1 antibody
Specificity KIAA0776 antibody was raised against the middle region of KIAA0776
Cross Reactivity Human
Applications WB
Immunogen KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR
Assay Information KIAA0776 Blocking Peptide, catalog no. 33R-2824, is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody

Images

Western Blot analysis using KIAA0776 antibody (70R-3793)

KIAA0776 antibody (70R-3793) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0776 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0776 antibody (70R-3793) | KIAA0776 antibody (70R-3793) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors