KIAA0907 antibody (70R-3513)

Rabbit polyclonal KIAA0907 antibody raised against the middle region of KIAA0907

Synonyms Polyclonal KIAA0907 antibody, Anti-KIAA0907 antibody, KIAA 0907 antibody, KIAA 0907, KIAA0907, Kiaa0907 antibody, KIAA-907, KIAA-907 antibody, RP11-336K24.1 antibody
Specificity KIAA0907 antibody was raised against the middle region of KIAA0907
Cross Reactivity Human
Applications WB
Immunogen KIAA0907 antibody was raised using the middle region of KIAA0907 corresponding to a region with amino acids ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER
Assay Information KIAA0907 Blocking Peptide, catalog no. 33R-2567, is also available for use as a blocking control in assays to test for specificity of this KIAA0907 antibody

Images

Western Blot analysis using KIAA0907 antibody (70R-3513)

KIAA0907 antibody (70R-3513) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0907 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA0907 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0907 antibody (70R-3513) | KIAA0907 antibody (70R-3513) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors